DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Cd63

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:252 Identity:62/252 - (24%)
Similarity:120/252 - (47%) Gaps:58/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTSMVKYILFIF-----NTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGS 63
            |...||::|::.     ...|.:|.| |:...|::.::|......|       :|:|:::|::|:
  Rat    30 GMKCVKFLLYVLLLAFCACAVGLIAI-GVAVQVVLKQAITHETTAG-------SLLPVVIIAVGA 86

  Fly    64 IVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHRE----EFENAMGNVIENAW 124
            .:..::|:|||||.:|:.|:.:::|.||.:::::::...:..:..|:    ||..:....::|..
  Rat    87 FLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYL 151

  Fly   125 NSEHTYKGGVFDTIQKSLHCCGSSSALDY-----IGKGDLVPPSCCSGSCLIPTNYYPGCRGKFV 184
            ....|  ..:.|.:||...|||:|:..|:     :.| |.||.|||       .|...||...|.
  Rat   152 TDNKT--ATILDKLQKENKCCGASNYTDWERIPGMAK-DRVPDSCC-------INITVGCGNDFK 206

  Fly   185 E--------------------LMTTGSDNAKYVGIGLIGIELIGFIFACCLANNVRN 221
            |                    |:..|:      .:|:..:|::|.||:|||..::|:
  Rat   207 ESTIHTQGCVETIAAWLRKNVLLVAGA------ALGIAFVEVLGIIFSCCLVKSIRS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 60/244 (25%)
tetraspanin_LEL 106..187 CDD:239401 25/109 (23%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 60/245 (24%)
ATP-synt_A <72..131 CDD:294288 16/65 (25%)
CD63_LEL 129..227 CDD:239419 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.