DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and CG30160

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster


Alignment Length:231 Identity:76/231 - (32%)
Similarity:124/231 - (53%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVE-----VNGQVGFPIQALMPIILIS 60
            |:|.::|.||:|::.|.:....|||.||.|.::|.::|...     ||.|.       :||.:|.
  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQT-------IPICIIV 58

  Fly    61 LGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWN 125
            :||:...::|.||||.|||:.|.|..||..:|||..|||...:.:|...::|.::||..::.||:
  Fly    59 IGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWD 123

  Fly   126 SEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCC---SGSCLIPTNYY---PGCRGKFV 184
            ..:..:|...|.:|.:..|||::....|    :.||.|||   ..:.:.....|   ||||.:||
  Fly   124 ENNAAQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFV 184

  Fly   185 ELMTTGSDNAKYVGIGLIGIELIGFIFACCLANNVR 220
            :...:.:|..::..:.:...||..||.:||||:.:|
  Fly   185 DFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 72/221 (33%)
tetraspanin_LEL 106..187 CDD:239401 25/86 (29%)
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 72/221 (33%)
tetraspanin_LEL 104..191 CDD:239401 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.