DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and Cd9

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_031683.1 Gene:Cd9 / 12527 MGIID:88348 Length:226 Species:Mus musculus


Alignment Length:247 Identity:69/247 - (27%)
Similarity:105/247 - (42%) Gaps:59/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTSMVKYILFIFNTIVSVIGILGIVYGVLI-----LKSIGVVEVNGQVGFPIQALMPIILISLGS 63
            |:..:||:||.||.|..:.||..:..|:.:     .|||...| |....|....   .|||..|:
Mouse     6 GSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQE-NNHSSFYTGV---YILIGAGA 66

  Fly    64 IVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEH 128
            :::.:.|||||||::||.||...:..|||::..:::...|..:||::|       ||:..   :.
Mouse    67 LMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDE-------VIKEL---QE 121

  Fly   129 TYKGGVFDTIQK-----------------SLHCCGSSSALDYIGKGDLVPPSCCSGSCLIPTNYY 176
            .||    ||.||                 :|.|||.:..|:     ..:..:|.....|......
Mouse   122 FYK----DTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLE-----QFISDTCPKKQLLESFQVK 177

  Fly   177 PGCRGKFVELMTTGSDNAKY-----VGIGLIGIELIGFIFA---CCLANNVR 220
            | |.....|:.     |.|:     ||||:..:.:.|.||:   ||.....|
Mouse   178 P-CPEAISEVF-----NNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 67/240 (28%)
tetraspanin_LEL 106..187 CDD:239401 21/97 (22%)
Cd9NP_031683.1 Tetraspannin 9..219 CDD:278750 67/238 (28%)
CD9_LEL 109..191 CDD:239405 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.