DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ee and TSPAN2

DIOPT Version :9

Sequence 1:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_005716.2 Gene:TSPAN2 / 10100 HGNCID:20659 Length:221 Species:Homo sapiens


Alignment Length:227 Identity:57/227 - (25%)
Similarity:102/227 - (44%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPI-ILISLGSIVVF 67
            |...:||:|..||.:..:.|...|.:|:.......:.|::.:...|....:.: :|:..|::::.
Human     7 GLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMMA 71

  Fly    68 ISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEHTYKG 132
            :.|.|||||:|||.|:..|:.|.||::...::|..|..|..:......:..:.|.|:|.....:|
Human    72 VGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRG 136

  Fly   133 ---GVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCCSGSCLIPTNY--YPGCRGKFVELMTTGSD 192
               |...|...:..|||..|:       :.|.|:|       |...  :..|..:...:::....
Human   137 KGNGTLITFHSTFQCCGKESS-------EQVQPTC-------PKELLGHKNCIDEIETIISVKLQ 187

  Fly   193 NAKYVGIGLIGIELIGFIFA---CCLANNVRN 221
            ....||||:.|:.:.|.||:   ||...|.|:
Human   188 LIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 54/219 (25%)
tetraspanin_LEL 106..187 CDD:239401 16/85 (19%)
TSPAN2NP_005716.2 Tetraspannin 11..210 CDD:395265 52/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.