DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and CD81

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004347.1 Gene:CD81 / 975 HGNCID:1701 Length:236 Species:Homo sapiens


Alignment Length:235 Identity:60/235 - (25%)
Similarity:107/235 - (45%) Gaps:32/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILF-----VICGILLITFGSIMVSTIKDFSGVGETFTANS--VAIIILV-LGCVVF 64
            :||:||:||.:|     ||.|:.|........:.:. :..:|:....|:  |.|.||: :|.|:.
Human    10 IKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLL-YLELGDKPAPNTFYVGIYILIAVGAVMM 73

  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDA 129
            .|.|:||.|||:|:.|.|.::...:::|...::|..|:.:|:..||    .|.|:..:||....|
Human    74 FVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQI----AKDVKQFYDQALQQA 134

  Fly   130 LLMD----------TLQRSFKCCGLNGFADYGITYPA---SCCDSPSNGTCALTQVMTRSSCLKA 181
            ::.|          |...:..|||.:...  .:|...   :.|.|.||    :...:.:..|.:.
Human   135 VVDDDANNAKAVVKTFHETLDCCGSSTLT--ALTTSVLKNNLCPSGSN----IISNLFKEDCHQK 193

  Fly   182 VDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRNS 221
            :|..:...:.:|..|.:.|..:.:...|.:..|....|||
Human   194 IDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 57/229 (25%)
tetraspanin_LEL 104..189 CDD:239401 20/97 (21%)
CD81NP_004347.1 Tetraspannin 10..226 CDD:395265 56/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.