DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and TSPAN8

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001356689.1 Gene:TSPAN8 / 7103 HGNCID:11855 Length:237 Species:Homo sapiens


Alignment Length:242 Identity:69/242 - (28%)
Similarity:123/242 - (50%) Gaps:42/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKD---FSGVGETFTANSVAI-IILVLGCVVFLVAF 68
            :||.:|.||.||.:||||::.. :|.|....|   ..|..:..:::.||: |::.:|.::.::.|
Human     8 IKYSMFTFNFLFWLCGILILAL-AIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGF 71

  Fly    69 MGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIV-QTIWDQRK------ 126
            :||||||:|:.|.|..:.:.:|::|:.|:|..|...|    .:...::|| :|:::..|      
Human    72 LGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAV----FKSKSDRIVNETLYENTKLLSATG 132

  Fly   127 ------TDALLMDTLQRSFKCCGL-NGFADYGIT---YPASC--------CDSPSNGTCALTQVM 173
                  .:|:::  .|..|||||| ||.||:|..   ||..|        |.| .||     :.:
Human   133 ESEKQFQEAIIV--FQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQS-YNG-----KQV 189

  Fly   174 TRSSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRN 220
            .:.:|:..:..|...|:.|:.....|:..:|::..:|:..|..|..|
Human   190 YKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 67/237 (28%)
tetraspanin_LEL 104..189 CDD:239401 27/109 (25%)
TSPAN8NP_001356689.1 Tetraspannin 8..230 CDD:334016 66/234 (28%)
TM4SF3_like_LEL 106..206 CDD:239407 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.