DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tspan1

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_598442.1 Gene:Tspan1 / 66805 MGIID:1914055 Length:240 Species:Mus musculus


Alignment Length:241 Identity:63/241 - (26%)
Similarity:108/241 - (44%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVKYVLFIFNILFVICGILLITFGSIMVST-----IKDFSGVGET---FTANSVAIIILVLGCVV 63
            |:|.::|:||:|..:||..|:..| |.||.     :|.|..:..:   |.  :|...::..|.|:
Mouse     6 FIKVMMFLFNLLIFLCGAALLAVG-IWVSVDGTSFLKVFGSLSSSAMQFV--NVGYFLIAAGAVL 67

  Fly    64 FLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIV---------- 118
            |::.|:||.||..||.|.|..:..::|::.::::|..:...|.....:|.|..:|          
Mouse    68 FILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTLAEQFLTLLVVPAIEKDYGY 132

  Fly   119 QTIWDQRKTDALLMDTLQRSFKCCGLNGFADYGIT--------YPASCCDSPSNGT---CALTQV 172
            ||.:.|      :.:|......|||.|.:.|:..:        :|..||.:|.|.|   |  |:.
Mouse   133 QTDFTQ------VWNTTMEELHCCGFNNYTDFNASRFVKENKVFPPPCCANPGNHTVEPC--TEE 189

  Fly   173 MTRS----SCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCL 214
            ..:|    .|.|.:......|...:....:||.|:||.|.:.:..|
Mouse   190 KAKSMKVQGCFKEILHRIRANAVTVGGVAVGVAALELAAMVVSMYL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 62/240 (26%)
tetraspanin_LEL 104..189 CDD:239401 24/109 (22%)
Tspan1NP_598442.1 Tetraspannin 7..235 CDD:366035 61/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.