DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:229 Identity:97/229 - (42%)
Similarity:142/229 - (62%) Gaps:5/229 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65
            |.||...|||:|||||:|..|||||||.||:::.|.:::.....|......|.:.:::||.::.|
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILL 65

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDAL 130
            :::.||||||||:.|...:||:::.||::.||||:||:||...:..:.:..:|:..|:.|.:.:.
  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD 130

  Fly   131 LMDTLQRSFKCCGLNGFADYGI--TYPASCCDSPSNGTCALTQVMTRSSCLKAVDSFWDTNVSII 193
            .||.:|.|.||||.:|:.||..  .:|.|||...:|  |. .:.:.|..|......|||.|..||
  Fly   131 YMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNN--CR-WETVYRRGCKVTFVEFWDRNSDII 192

  Fly   194 KYAGLGVTAVELVAFIFACCLANQTRNSQRRQNY 227
            |||||.:.|:|.|.|:|||||||..||.:||..|
  Fly   193 KYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 88/210 (42%)
tetraspanin_LEL 104..189 CDD:239401 27/86 (31%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 89/211 (42%)
tetraspanin_LEL 104..188 CDD:239401 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467675
Domainoid 1 1.000 166 1.000 Domainoid score I8000
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I6383
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 1 1.000 - - otm50378
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11759
109.900

Return to query results.
Submit another query.