DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tspan3b

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001076335.1 Gene:tspan3b / 569864 ZFINID:ZDB-GENE-070424-42 Length:253 Species:Danio rerio


Alignment Length:229 Identity:57/229 - (24%)
Similarity:113/229 - (49%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVA 67
            ||.:..|.||...|::|.....:|...|:.:..|..|:....|.......|::|:.:|.::|::.
Zfish     4 CGVISSKTVLVFLNLIFWAAAGILCYIGAYVFITYDDYDHFFEDIYTFIPAMVIIAVGTLLFVIG 68

  Fly    68 FMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRK---TDA 129
            |:|||..|||:.|.|.::|.|:|::..:::.:::..::...:::..:...:|.::::.|   |||
Zfish    69 FIGCCATIRESRCGLVTFSAVLLLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYNEYKGTNTDA 133

  Fly   130 --LLMDTLQRSFKCCGLNGFADYGITY----------PASCCD---SPSNGTCALTQVMTRSSC- 178
              ..:|.:||...|||::.::|:..|:          |.|||.   |...||......:....| 
Zfish   134 PSRAIDYVQRQLHCCGIHNYSDWMNTHWFIESKNNSVPVSCCKPTISNRTGTLMRPGDLYPEGCE 198

  Fly   179 LKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFAC 212
            :..|....|..:.:| .|.|...|::::..:.||
Zfish   199 VLVVKKLKDIMLYVI-LAALTFAAIQMLGLLCAC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 55/224 (25%)
tetraspanin_LEL 104..189 CDD:239401 23/103 (22%)
tspan3bNP_001076335.1 Tetraspannin 10..237 CDD:278750 55/223 (25%)
Tweety_N <58..>94 CDD:299916 14/35 (40%)
TM4SF8_like_LEL 104..209 CDD:239416 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.