DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tspan3

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001017023.1 Gene:tspan3 / 549777 XenbaseID:XB-GENE-868507 Length:253 Species:Xenopus tropicalis


Alignment Length:249 Identity:56/249 - (22%)
Similarity:113/249 - (45%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVA 67
            ||.:..|.||...|::|.....:|...|:.:..|..|:....|........:||:..|.::|::.
 Frog     4 CGLISSKTVLVFLNLIFWAAAGILCYVGAYVFITYDDYDHFFEDVYTLIPGVIIIAAGTLLFIIG 68

  Fly    68 FMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRK-----T 127
            .:|||..|||:.|.|.::.|::|::.|:::.:::..::...:::..::..:..:::|..     :
 Frog    69 LIGCCATIRESRCGLATFVVILLLVFVTEVVVVVLGYIYRAKVEDEVDNTIANVFNQYNGISPDS 133

  Fly   128 DALLMDTLQRSFKCCGLNGFADYGIT----------YPASCC---------------DSPSNGTC 167
            .:..:|.:||...|||::.:.|:..|          .|.|||               |..|.|..
 Frog   134 ASRAIDYVQRQLHCCGIDNYLDWENTPWFSEAKNNSVPLSCCRNYVFNCTGSMNKPGDLYSEGCK 198

  Fly   168 ALTQVMTRSSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFAC-CLANQTRN 220
            ||           .|:...:..:.:| :|.|...|::|:..:.|| .|..:||:
 Frog   199 AL-----------VVEKLQEIMMYVI-WAALAFAAIQLLGMLCACIVLCRRTRD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 52/239 (22%)
tetraspanin_LEL 104..189 CDD:239401 19/114 (17%)
tspan3NP_001017023.1 Tetraspannin 9..232 CDD:366035 50/234 (21%)
TM4SF8_like_LEL 104..210 CDD:239416 19/116 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.