DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and cd81b

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001003735.1 Gene:cd81b / 445280 ZFINID:ZDB-GENE-040808-52 Length:238 Species:Danio rerio


Alignment Length:230 Identity:50/230 - (21%)
Similarity:95/230 - (41%) Gaps:20/230 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILF-----VICGILLITFGSIMVSTI--KDFSGVGETFTANSVAIIILVLGCVVFL 65
            :||:||..|.:|     ||.|:.|........|.:  ..|.|.....|......:::.:|.::..
Zfish    10 IKYMLFFLNFIFWLAGGVILGVALWLRHDSQTSNLLMLQFEGNQAPGTFYISVYVLIAIGAIMMF 74

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIW-------- 122
            |.|:||.|||:|:.|.|.::...:::|...::|..|:.:::...|...|.......:        
Zfish    75 VGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFINRDTISTELINFYDAAYIKAVDPVD 139

  Fly   123 -DQRKTDALLMDTLQRSFKCCGLNGFADYGITYPASCCDSPSNGTCALTQVMTRSSCLKAVDSFW 186
             ..|:|.:.:::....:..|||.....|.......|.|...   |..|..:::: ||...:.:.:
Zfish   140 TTSRQTASKVLEVFHDNLDCCGKGDDNDLFKVVQTSLCPKK---TFPLDPLISQ-SCHVKLRNLF 200

  Fly   187 DTNVSIIKYAGLGVTAVELVAFIFACCLANQTRNS 221
            ...:.:|..|.|.:..:.:...||...|....||:
Zfish   201 SEKLHVIGLAALVIAVIMVFEMIFTMVLCCAIRNA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 48/224 (21%)
tetraspanin_LEL 104..189 CDD:239401 14/93 (15%)
cd81bNP_001003735.1 Tetraspannin 9..232 CDD:278750 48/225 (21%)
CD81_like_LEL 113..204 CDD:239404 14/94 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.