DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tspan4a

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_009292176.1 Gene:tspan4a / 436620 ZFINID:ZDB-GENE-040718-38 Length:321 Species:Danio rerio


Alignment Length:223 Identity:59/223 - (26%)
Similarity:106/223 - (47%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCC 72
            ::|.:..||:||.:||..::..|..:..|..:|:.:..:..:.|.|.:::..|.||.::..:||.
Zfish    91 LRYGMVFFNLLFWLCGCGILGVGVWLSITQGNFATLSSSLPSLSAANLLIAAGTVVMVIGCLGCV 155

  Fly    73 GAIRENSCALTSYSVVMLVLLVSQLALII--YVWVDHVQI--QQSLEKIVQTIWDQRK---TDAL 130
            ||::||...|.|:.:::|::.:.::..||  :.:.|.:.:  |..|:|.:|....:..   |:| 
Zfish   156 GAVKENRPLLLSFFILLLLIFLLEILFIILFFSYQDQIDLYAQNDLKKGLQLFGTEGNIGLTNA- 219

  Fly   131 LMDTLQRSFKCCGLNGFADYGITY-----PASCCDSPSNGTCALTQVMT--RSSCLKAVDSFWDT 188
             ...:|..|:|||:....|:...|     |.|||...|: .|.|....|  .:.|.:.|..:...
Zfish   220 -WSIVQTDFRCCGVTNHTDWFQVYNTSRVPDSCCLEYSD-NCGLENPGTWWTAPCYERVKGWLQE 282

  Fly   189 NVSIIKYAGLGVTAVELVA-FIFACCLA 215
            |               ||| :|||.|.|
Zfish   283 N---------------LVALWIFALCTA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 59/223 (26%)
tetraspanin_LEL 104..189 CDD:239401 24/96 (25%)
tspan4aXP_009292176.1 Tetraspannin 91..311 CDD:278750 59/223 (26%)
NET-5_like_LEL 189..284 CDD:239418 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.