DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and cd9b

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_005164541.1 Gene:cd9b / 406737 ZFINID:ZDB-GENE-040426-2768 Length:231 Species:Danio rerio


Alignment Length:239 Identity:61/239 - (25%)
Similarity:116/239 - (48%) Gaps:35/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTA-NSVAI------IILV 58
            :..|...:||::|.||.:..:.|..::..|..:....|    ..|.||| |...:      |::|
Zfish     7 LSSGEQCIKYIIFFFNFMLWLAGTGVLAVGLWLRFDAK----TKEFFTAENGQTVFLTGVYILIV 67

  Fly    59 LGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKI-VQTIW 122
            .|.|:.:|.|:||||||:|::|.|..:.:.:||:..:::|..|:...:..:|...:::. .||:.
Zfish    68 AGAVMMVVGFLGCCGAIKESACMLGLFFMFLLVIFAAEVAAGIWGLSNKDKIVSDIQQFYTQTVK 132

  Fly   123 DQRKT-DALLMDTLQR---SFKCCGLNGFADYGITYPASCCDSPSNGTC----ALTQVMTRSSCL 179
            :.::: |..|.:||..   |.:|||..|....|::.           ||    .|..|:| :.|.
Zfish   133 NYKESPDGPLKETLTAIHFSLQCCGPTGLVTDGVSV-----------TCPKQEGLANVIT-TGCS 185

  Fly   180 KAVDSFWDTNVSIIKYAGLGVTAVELVAFIFA---CCLANQTRN 220
            ..:...:::.:.:|...|:|:..:.:...||:   ||...:||:
Zfish   186 SVIQDMFNSRLHVIGGVGIGIGVIMVFGMIFSMLLCCAIRRTRD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 58/227 (26%)
tetraspanin_LEL 104..189 CDD:239401 19/93 (20%)
cd9bXP_005164541.1 Tetraspannin 13..224 CDD:278750 58/226 (26%)
CD9_LEL 113..196 CDD:239405 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.