DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tspan2a

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001018160.1 Gene:tspan2a / 378854 ZFINID:ZDB-GENE-050522-511 Length:211 Species:Danio rerio


Alignment Length:228 Identity:54/228 - (23%)
Similarity:109/228 - (47%) Gaps:33/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIM-----VSTIKDFSGVGETFTANSVAIIILV-L 59
            |.|    |||:||:||.:|.:.|.|::..|..:     .:::...:...|.|   .:|:.||: .
Zfish     8 MKC----VKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAPENF---FIAVYILIGA 65

  Fly    60 GCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQ 124
            |.::.:|.|.||.||:||:.|.|.|:...:|::..:::|..::.:::..||.:.::...::. .:
Zfish    66 GGIMMIVGFFGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFLNKDQIIKEVQNYYESA-TK 129

  Fly   125 RKTDALLMDTLQRSFKCCGLNGFADYGITYPASCCDSPSNGTCALTQVMTRSSCLKAVDSFWDTN 189
            .:...::.........|||..       :.|...|...:            ..|::|::.|::..
Zfish   130 MENGTVITSAFHSVLDCCGTE-------SSPIETCTEGN------------KDCVQAIEDFFNEK 175

  Fly   190 VSIIKYAGLGVTAVELVAFIFACCLANQTRNSQ 222
            :.||.|.|:|:..|.::..||:..|....|||:
Zfish   176 LFIIGYVGIGIAGVMVIGMIFSMVLCCAIRNSR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 49/214 (23%)
tetraspanin_LEL 104..189 CDD:239401 10/84 (12%)
tspan2aNP_001018160.1 Tetraspannin 10..204 CDD:278750 50/220 (23%)
tetraspanin_LEL 110..176 CDD:243179 10/85 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.