DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and TM4SF

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:226 Identity:56/226 - (24%)
Similarity:100/226 - (44%) Gaps:27/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSV---AIIILVLGCVVFLVAFMG 70
            ||:::.:.:|..:.|...|..|:.::.....:.|:    ..|.:   |.|:|.||.|.|::.:||
  Fly    11 KYLVYSYVVLLALTGAAQIFLGTSLLWGHSVYYGI----VQNKLWAPAAILLCLGPVTFILCWMG 71

  Fly    71 CCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWD-----------Q 124
            |....:...|.|..::.:::..:..|  .||..|  .:.::::|...|:...|           :
  Fly    72 CQATNQRKRCLLGMFAALLVACICVQ--FIICGW--SLAMRENLPTSVEIFIDDSFVEFLDKFSR 132

  Fly   125 RKTDAL-LMDTLQRSFKCCGLNGFADY-GITYPASCCDSPSNGTCALTQVMTRSSCLKAVDSFWD 187
            .|.|.| |.:.:|...:|||::|..|| .::.|.|||..|.:...:......:..|| ||.|...
  Fly   133 TKVDNLHLWNRMQSQLQCCGVDGPLDYRRLSLPWSCCSRPEHAYESACDTHYKRGCL-AVVSEQI 196

  Fly   188 TNVSIIKYAGLGVTAVELVAFIFACCLANQT 218
            .|..:|...|..:.|:.....||  |..:.|
  Fly   197 RNRLLITAFGAAIIAIFQSLGIF--CAVHLT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 55/223 (25%)
tetraspanin_LEL 104..189 CDD:239401 25/97 (26%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 55/223 (25%)
uroplakin_I_like_LEL 111..197 CDD:239409 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.