DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:237 Identity:61/237 - (25%)
Similarity:101/237 - (42%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILV--LGCVV 63
            |.|....||..|...|.|..:.|:.||...::.:|..             .:|.|:.:  ||.::
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSKA-------------PIAYILFLYGLGGII 52

  Fly    64 FLVAFMGCCGAIRENSCALTSYSVVMLV-LLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKT 127
            |:.|.:||||...||.|...:|..::|. |::|.|.:..:.:.:. .|::...:.||..||:...
  Fly    53 FVSAVLGCCGICMENVCMTATYGFLLLAQLIISLLGIFRFKFTEE-YIEKFAAEEVQMKWDEELV 116

  Fly   128 DALLMDTLQRSFKCCGLNGFADYGI----TYPASCC--DSPSNGTCALTQVMTRSSCLKAVDSF- 185
            :...||..|..::|||.:...||..    |.|.||.  :.|.........|...|.....:.|: 
  Fly   117 EPGAMDIYQTVYECCGRDSPDDYVAIGRQTLPPSCYPQEDPQMPHYLAGCVQKSSENFVVLFSYA 181

  Fly   186 WDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRNSQRRQNY 227
            .|||     :..||:|.:.::|..:   |..:.|..:.|..|
  Fly   182 HDTN-----WIALGITILMMIAAFY---LVGRFRKQRVRYTY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 56/218 (26%)
tetraspanin_LEL 104..189 CDD:239401 22/91 (24%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 55/216 (25%)
tetraspanin_LEL 94..174 CDD:239401 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.