DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:218 Identity:47/218 - (21%)
Similarity:87/218 - (39%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYVLFIFNILFVICGILLITFG-SIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCC 72
            ||.|.:..||.|.|.:...:.| :...|.:..:...|..           :.|..||.|||:|..
  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSA-----------LCGGAVFGVAFLGMY 64

  Fly    73 GAIRENSCALTSYSVVMLV---LLVSQLALIIYVWVD-HVQIQQSLEKIVQTIWDQRKTDALLMD 133
            .|::.:    ..||:..|:   |:::.|...::.:.. ..|:....|:.::.:::::......|.
  Fly    65 VALKVS----YKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDKMQ 125

  Fly   134 TLQRSFKCCGLNGFADY-----GITYPASC-----CDSPSNGTCALTQVMTRSSCLKAVDSFWDT 188
            .:...|.|||:.|..||     | ..|:||     |..|::       |.......|||.:. ..
  Fly   126 PVHSLFGCCGIEGPQDYLQEEHG-ALPSSCCYAFDCSKPAH-------VYEEGCSTKAVATL-RM 181

  Fly   189 NVSIIKYAGLGVTAVELVAFIFA 211
            ...:..|:.:.:.|:|.:....|
  Fly   182 QAELNYYSCMAIIALEFLGLFTA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 47/218 (22%)
tetraspanin_LEL 104..189 CDD:239401 20/95 (21%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 47/218 (22%)
tetraspanin_LEL 97..183 CDD:239401 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.