DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:240 Identity:55/240 - (22%)
Similarity:100/240 - (41%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSG-VGETFTANSVAIIILVLGCVVF 64
            |.|....::|||.:.:.:..:.|.|||.:|:.::.::.:... :|.....:..|::.::||.|:.
  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIV 65

  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALI-IYVWVDHVQIQQSLEKIVQTIWDQRKTD 128
            :.:..|.....:::...|..|:|:::.||:.|:.|: |........:..||.:.:..:||.:...
  Fly    66 VASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQHEG 130

  Fly   129 ALLMDTLQRSFKCCGLNGFADY---GITYPASCCDSPSNGTCALTQVMTRSSCLKAVDSFW-DTN 189
            ...::|.:....|||.|...||   ....|.|||              ....|.|.::.|. ...
  Fly   131 NSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCC--------------LNRDCTKHLNLFMTGCE 181

  Fly   190 VSIIKYAGLGVTAVE-----LVAFIFA-----CCLANQTRNSQRR 224
            |...:|.|.......     ||.|.||     |.|.:..||.:.|
  Fly   182 VKFKEYVGAKTANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 50/224 (22%)
tetraspanin_LEL 104..189 CDD:239401 18/88 (20%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 50/225 (22%)
tetraspanin_LEL 109..192 CDD:239401 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.