DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:228 Identity:50/228 - (21%)
Similarity:94/228 - (41%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCC 72
            ||.:::..::|..:..::||:|| |.|:...:.:.:|:......|.     ||....||...|..
  Fly     7 VKLIVYALDVLCTLLALVLISFG-IYVAVSYNLNEIGQLTAYGYVG-----LGAAALLVVLWGYL 65

  Fly    73 GAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDALLMDTLQR 137
            .|.|||.|...::.:.:.:::::|.|::..:......:..:|...::..|::.......|...|.
  Fly    66 SAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSLYQN 130

  Fly   138 SFKCCGLNGFADYGIT--YPASCC------DSPSNGTCALTQVMTRSSCLKAVDSFWDTNVSIIK 194
            .|:|||.....||.:.  .|...|      ..|.|        :..:.|....:::|.....|..
  Fly   131 WFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPEN--------LIHTGCRVEFENYWQHLTKIFN 187

  Fly   195 YAGLGVTAVELVAFIFACCLANQTRNSQRRQNY 227
            ...|.:...||:..:.:|.|.|..||..||..:
  Fly   188 ILALVLIGFELLLSVISCRLCNSIRNDARRSYF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 45/216 (21%)
tetraspanin_LEL 104..189 CDD:239401 16/92 (17%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 46/217 (21%)
tetraspanin_LEL 103..181 CDD:239401 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443011
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.