DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:233 Identity:80/233 - (34%)
Similarity:125/233 - (53%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65
            |.|....|.::|:|.||:|:|.|||||..||||:|.:..|...|.....|::.|.:.|||.::|:
  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFV 65

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDAL 130
            |:|.||.|..|::.|...:|:.::.||.:.||.|..:|:|:.......:..:|..:||..  |..
  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDSH--DYT 128

  Fly   131 LMDTLQRSFKCCGLNGFADY---GITYPASCCD-SPSNGTCALTQV-MTRSSCLKAVDSFWDTNV 190
            .|..|:.:|.|||...:.:|   |::.|.:||. .....||....| .:|..|....:.||:.|:
  Fly   129 AMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEFWNDNM 193

  Fly   191 SIIKYAGLGVTAVELVAFIFACCLANQTRNSQR-RQNY 227
            .||:::|||:...:||.|:.|..|.|..|:... ||.|
  Fly   194 DIIRWSGLGLCIFDLVVFLIAGALTNCMRSQNAGRQVY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 73/213 (34%)
tetraspanin_LEL 104..189 CDD:239401 23/89 (26%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 74/215 (34%)
tetraspanin_LEL 104..193 CDD:239401 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467673
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.