DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp33B

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:284 Identity:55/284 - (19%)
Similarity:96/284 - (33%) Gaps:98/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFIFNILFVICGILLIT----FGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCC 72
            |.:..|...:.|:|::.    :.:::...:.|.    |..........|.|.|..| :|.|:   
  Fly    12 LHLLLITEAVIGLLILVVTAYYHTVLTGYLSDI----ECRLVYGYLFGIYVFGAQV-VVTFL--- 68

  Fly    73 GAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQT----IWD-QRKTDA--- 129
                   |::..:..:........:.|::.||..:..:      |:.:    :|: .|..|.   
  Fly    69 -------CSIAMWRRIWRRRCTPNIRLLLSVWAFYSCV------IIASGFGCVWNLYRGVDVLEN 120

  Fly   130 --------------------LLMDTLQRSFKCCGLNGFADY---------------GITYPASC- 158
                                ||.|.||...:|||::|:.|:               .:..|.:| 
  Fly   121 AADTSLTRGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACC 185

  Fly   159 ---CDS------PSNGTC----------ALT-QVMTRSSCLKA-VDSFWDTNVSIIKYAGLGVTA 202
               |||      ||.|..          ||| ..:..:.||.| |.:.|:     ..|..:.:..
  Fly   186 KRSCDSCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVWN-----CFYILMALWV 245

  Fly   203 VELVAFIFACCLANQTRNSQRRQN 226
            :.|...|..||:   |:....|||
  Fly   246 LALKFLIVLCCM---TKFIVHRQN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 51/273 (19%)
tetraspanin_LEL 104..189 CDD:239401 31/149 (21%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 47/261 (18%)
CD151_like_LEL 112..237 CDD:239408 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443012
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.