DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:105/229 - (45%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65
            |.|    .||:|.|.:.:|.:..||||..|:.:.:...|||...:...::..|::| .:|.::..
  Fly    12 MKC----AKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFSSPPALLI-AIGFILIA 71

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDAL 130
            ||.:|..||::|:...:..|.|.:.::.:.:::..|..:|...|::..|.:.:.....:.:.|..
  Fly    72 VAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEYEHDPY 136

  Fly   131 L---MDTLQRSFKCCGLN---GFADY------------GITYPASCCDSPSNGTCALTQVMTRSS 177
            :   :|.:|...:|||:|   .:.||            .:..|.|||   .|...:|.. .|:.:
  Fly   137 VESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCC---GNQPTSLND-STQMT 197

  Fly   178 CLKAVD--SFWDTNVSIIKYAGLGVTAVELVAFI 209
            |::..|  .|...|..:.:.|.|..|....|||:
  Fly   198 CMETYDYGCFRKMNFIVSQSAMLIATGATTVAFV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 54/222 (24%)
tetraspanin_LEL 104..189 CDD:239401 22/104 (21%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 55/227 (24%)
tetraspanin_LEL 110..218 CDD:239401 23/111 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.