DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp26A

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster


Alignment Length:292 Identity:63/292 - (21%)
Similarity:117/292 - (40%) Gaps:87/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGET-FTANSVAIIILVLGCVVFLVAFMGC 71
            :||:||..|::..:..:|:::.|....|....|..:... |.|...|.::::||.|.||:.|||.
  Fly    19 LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLGFMGS 83

  Fly    72 CGAIRENSCALTSYSVVMLVLLVSQLAL--IIYVWVDHVQIQQSLEKIVQTIWDQRKTDA---LL 131
            .||:|||:|.|.:|::.:.|||::::..  :.:|..|...|:....:.::......:.||   .|
  Fly    84 VGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNL 148

  Fly   132 MDTLQRSF-KCCGLNGFADY-------------------GITYPASCC-----DSPSNGTCA--- 168
            :|.:|..: :|||::|..|:                   |:  |.|||     :...|..|.   
  Fly   149 IDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGV--PFSCCRRRPQEVIKNKQCGYDV 211

  Fly   169 ---------------------------------------------LTQVMTRSSCLKAVDSFWDT 188
                                                         |::::....|::|.:.:.:.
  Fly   212 RKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYEKGCVQAGEEWMEH 276

  Fly   189 NVSIIKYAGLGVTAVELVAF-IFACCLANQTR 219
            |:.||     ..|.:.::.| |...|.|...|
  Fly   277 NLIII-----SATVIVVMFFQILGICFAQNLR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 62/288 (22%)
tetraspanin_LEL 104..189 CDD:239401 22/160 (14%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 51/235 (22%)
DUF2207 <65..157 CDD:303056 28/91 (31%)
TM4SF9_like_LEL 118..239 CDD:239412 19/122 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.