DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and cd9a

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_005159038.1 Gene:cd9a / 322455 ZFINID:ZDB-GENE-030131-1175 Length:228 Species:Danio rerio


Alignment Length:230 Identity:56/230 - (24%)
Similarity:103/230 - (44%) Gaps:25/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGVFVKYVLFIFNILFVICGILLITFGSIM---VSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65
            |.:.|||::|:||.:|.|.|..::..|..:   ..|...|.|....:...:...|::..|.::.:
Zfish     7 GEMCVKYLMFVFNFIFWIAGTAVLAVGLWLRFDPKTKSLFEGENSPYVFYTGVYILIAAGALMMV 71

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWD---QRKT 127
            |.|.||||||:|:.|.|..:...:||:...::|..|:.:.:..::.:.:....:..:|   |.|.
Zfish    72 VGFFGCCGAIQESPCMLGLFFFFLLVIFAVEVAAGIWGFSNQTKVTEDITTFYRQTYDTYQQSKQ 136

  Fly   128 DAL--LMDTLQRSFKCCGLNGFADYGITYPASCCDSPSNGTCALTQVMTR---SSCLKAVDSFWD 187
            :||  .:...|....|||           |:.......:.||...:.:..   .||..|:|..::
Zfish   137 EALKKTLRLFQHGLNCCG-----------PSGNMQESLDETCPKKEGLDNLIIKSCPDAIDEVFN 190

  Fly   188 TNVSIIKYAGLGVTAVELVAFIFA---CCLANQTR 219
            :.:.||...|:....:.:...||:   ||...:||
Zfish   191 SKLHIIGGVGIATGVIMIFGMIFSMMLCCAIRKTR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 53/222 (24%)
tetraspanin_LEL 104..189 CDD:239401 16/92 (17%)
cd9aXP_005159038.1 Tetraspannin 10..221 CDD:278750 53/221 (24%)
CD9_LEL 110..193 CDD:239405 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.