DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp2A

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:239 Identity:50/239 - (20%)
Similarity:97/239 - (40%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANS--VAIIILV-LGCVVFLVAFM 69
            |||.||.|||:..:....|... ::.:.....|:.......|.|  :.:.:|: :..|:..|:|:
  Fly    19 VKYTLFCFNIVAWMISTALFAL-TVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFL 82

  Fly    70 GCCGAIRENSCALTSY---SVVMLVLLVSQLALIIYVWVDHVQIQQ----SLEKIVQTIWDQRKT 127
            ||..|:.||:.||..:   .|...:.:|:..|:::.....:..:|.    ||...|.|  .:...
  Fly    83 GCLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVAT--SEYTY 145

  Fly   128 DALLMDTLQRSFKCCGLNG---FADYGITYPASCCDSPS-----NGTCALTQVMTRSSCLKAVDS 184
            ...::..:|.:..|||..|   :.|.....|:||.|:.|     ||            |:..:..
  Fly   146 SNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNG------------CVDELTW 198

  Fly   185 FWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRNSQRR-QNY 227
            |::.....|....:.:..:.::..:.:..|....:..:.: .||
  Fly   199 FFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEEQASNY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 48/226 (21%)
tetraspanin_LEL 104..189 CDD:239401 20/96 (21%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 48/227 (21%)
tetraspanin_LEL 116..204 CDD:239401 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.