DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tspan3

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001005547.1 Gene:Tspan3 / 300733 RGDID:1359444 Length:253 Species:Rattus norvegicus


Alignment Length:237 Identity:55/237 - (23%)
Similarity:115/237 - (48%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVA 67
            ||....|.||...|::|.....:|...|:.:..|..|:....|.......|::|:.:|.::|::.
  Rat     4 CGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLFPAVVIMAVGALLFIIG 68

  Fly    68 FMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTI---WDQRKTDA 129
            .:|||..|||:.|.|.::..::|::.|:::.:::..:|...:::..:::.:|.:   ::...:||
  Rat    69 LIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNSDA 133

  Fly   130 L--LMDTLQRSFKCCGLNGFADYGIT----------YPASCCDSPS---NGTCALTQVMTRSSCL 179
            .  .:|.:||...|||::.::|:..|          .|.|||...:   ||:.|....:....|.
  Rat   134 ASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETARSCNGSLANPSDLYAEGCE 198

  Fly   180 KAVDSFWDTNVSIIKYAGLGVTAVELVAFIFAC-CLANQTRN 220
            ..|.......:..:.:|.|...|::|:..:.|| .|..::|:
  Rat   199 ALVVKKLQEILMHVIWAALAFAAIQLLGMLCACIVLCRRSRD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 52/227 (23%)
tetraspanin_LEL 104..189 CDD:239401 21/102 (21%)
Tspan3NP_001005547.1 Tetraspannin 10..237 CDD:278750 52/226 (23%)
TM4SF8_like_LEL 104..210 CDD:239416 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.