DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Cd63

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:234 Identity:69/234 - (29%)
Similarity:127/234 - (54%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65
            |.|    ||::|::..:.|..|.:.||..| :.|..:...:...||...:.:.::|:.:|..:||
  Rat    31 MKC----VKFLLYVLLLAFCACAVGLIAIG-VAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFL 90

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALII--YVWVDHV--QIQQSLEKIVQTIWDQRK 126
            |||:|||||.:||.|.:.::::.:.::::.::|:.|  ||:.|.|  :..:|.:|.:|......|
  Rat    91 VAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNK 155

  Fly   127 TDALLMDTLQRSFKCCGLNGFADY----GIT---YPASCCDSPSNGTCA---LTQVMTRSSCLKA 181
            | |.::|.||:..||||.:.:.|:    |:.   .|.|||.:.:.| |.   ....:....|::.
  Rat   156 T-ATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVG-CGNDFKESTIHTQGCVET 218

  Fly   182 VDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRN 220
            :.::...||.::..|.||:..||::..||:|||....|:
  Rat   219 IAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 66/222 (30%)
tetraspanin_LEL 104..189 CDD:239401 24/96 (25%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 67/228 (29%)
ATP-synt_A <72..131 CDD:294288 18/58 (31%)
CD63_LEL 129..227 CDD:239419 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.