DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Cd9

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_444177.1 Gene:Cd9 / 24936 RGDID:2318 Length:226 Species:Rattus norvegicus


Alignment Length:230 Identity:58/230 - (25%)
Similarity:108/230 - (46%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANS---VAIIILV-LGCVVF 64
            |...:||:||.||.:|.:.||.::..| :.:........:.|..|.:|   ..:.||: .|.::.
  Rat     6 GSKCIKYLLFGFNFIFWLAGIAVLAIG-LWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMM 69

  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQ-RKTD 128
            ||.|:|||||::|:.|.|..:...:||:...::|..::.:....::.:.|::..:..:.: |..|
  Rat    70 LVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKD 134

  Fly   129 ALLMDTLQ---RSFKCCGLNGFADYGITYPASCCDSPSNGTCALTQVMTR---SSCLKAVDSFWD 187
            ....:||:   .:..|||:.|..:..|           :..|...||:..   .||..|:|..:.
  Rat   135 EPQRETLKAIHMALNCCGIAGGVEQFI-----------SDICPKKQVLESFQVKSCPDAIDEVFH 188

  Fly   188 TNVSIIKYAGLGVTAVELVAFIFA---CCLANQTR 219
            :...||...|:|:..|.:...||:   ||...::|
  Rat   189 SKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 56/222 (25%)
tetraspanin_LEL 104..189 CDD:239401 17/91 (19%)
Cd9NP_444177.1 Tetraspannin 10..215 CDD:395265 54/216 (25%)
CD9_LEL 109..191 CDD:239405 17/92 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.