DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and CG30160

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster


Alignment Length:221 Identity:85/221 - (38%)
Similarity:123/221 - (55%) Gaps:3/221 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65
            |:|.....||:|::.|::||..|||||..||||:||:.:|:.........::.|.|:|:|.|.|:
  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV 65

  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRK-TDA 129
            |||.||||.||||:|..|.|::.||:|...||||.|:::..:.:...|:.|.|...||:.. ...
  Fly    66 VAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQG 130

  Fly   130 LLMDTLQRSFKCCGLNGFADYGITYPASCCD-SPSNGTCALTQVMTRSSCLKAVDSFWDTNVSII 193
            ..||.||.:|.|||..|:..|. |.|:|||. ......|.......|..|.:....||.:|..:|
  Fly   131 YPMDALQLAFSCCGNTGYQQYE-TVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFVDFWASNTDLI 194

  Fly   194 KYAGLGVTAVELVAFIFACCLANQTR 219
            :::.|.:...||..||.:||||:..|
  Fly   195 RWSSLIIALFELGIFIMSCCLASAMR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 82/210 (39%)
tetraspanin_LEL 104..189 CDD:239401 25/86 (29%)
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 82/211 (39%)
tetraspanin_LEL 104..191 CDD:239401 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.