DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tsp-7

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_492636.1 Gene:tsp-7 / 192062 WormBaseID:WBGene00006633 Length:232 Species:Caenorhabditis elegans


Alignment Length:231 Identity:70/231 - (30%)
Similarity:115/231 - (49%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGV-FVKYVLFIFNILFVICGILLITFGSIM---VSTIKDFSGVGETFTANSVAIIILVLGCVVF 64
            ||| .|||:||:.|::..:.|:.||..|||:   ...:.|..|.....|    .|::||:|.:..
 Worm     4 GGVTIVKYLLFLANLVLWVGGLSLIIVGSILQLKFDNVLDILGDERLAT----PILLLVIGSLCT 64

  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDH--------VQIQQSLEKI---- 117
            |:.|:|||||||||.|...|::|::.:|:..::|.:|..:..|        .|:|..:.:.    
 Worm    65 LLGFLGCCGAIRENYCLTVSFAVLLALLITCEIAAVIIGYALHDSFRLGIGNQLQTGMVRYHESR 129

  Fly   118 -VQTIWDQRKTDALLMDTLQRSFKCCGLNGFADY--GITYPASCCDSPSNGTCALTQVMTRSSCL 179
             |::.||  ||..|        |:|||:...:|:  ..|.|.|||.....|.......:....|:
 Worm   130 GVESAWD--KTHQL--------FECCGVTNSSDWLTFTTIPDSCCIEEIEGCARENAPLFEPGCI 184

  Fly   180 KAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLA 215
            .:|:.:...|.:::......:.|::||...|||||:
 Worm   185 HSVEQWVLKNGAMVGGICAVLAAIQLVGVCFACCLS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 67/226 (30%)
tetraspanin_LEL 104..189 CDD:239401 22/99 (22%)
tsp-7NP_492636.1 Tetraspannin 8..223 CDD:278750 67/227 (30%)
NET-5_like_LEL 104..195 CDD:239418 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.