DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tsp-5

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_502621.3 Gene:tsp-5 / 192061 WormBaseID:WBGene00006631 Length:241 Species:Caenorhabditis elegans


Alignment Length:236 Identity:51/236 - (21%)
Similarity:99/236 - (41%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFS-GVGETFTANSVA------------III 56
            |....::.||.|:..::.|:::..:...||  :..|. .|..|...|.::            |.|
 Worm     7 GKLANFLFFILNLGLIVVGVIITWYSIWMV--LHQFEVTVARTSLVNLLSVDNIECFYVYRTISI 69

  Fly    57 LVLGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSL-----EK 116
            ::.||:|.| .|.||......:..||:.:.|::.::.|.::..|:....::..:::..     ::
 Worm    70 MIGGCMVVL-GFCGCFAVGFGSKTALSVHLVLVFIVFVVKIVAIVMFLANNDHLRREFVGVYRDE 133

  Fly   117 IVQTIWDQRKTDALLMDTLQRSFKCCGLNGFADY--GITYPASCCDSPSNGTCALTQVMTR-SSC 178
            :|....:..:|...| |.:..|.||||.||..|:  ...:|.||       .|.....:.| ..|
 Worm   134 LVANYHNNSRTKNTL-DWVHTSLKCCGANGCEDFLPAGNFPTSC-------ECGTKNAVVRMEGC 190

  Fly   179 LKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTR 219
            .....:.::.....:.:.||....:||...|||..:.::.|
 Worm   191 ALITWAVFEDGTLQVAFLGLICMLIELGLMIFAAIVIDRIR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 49/229 (21%)
tetraspanin_LEL 104..189 CDD:239401 18/92 (20%)
tsp-5NP_502621.3 Tetraspannin 11..223 CDD:278750 47/222 (21%)
tetraspanin_LEL 116..191 CDD:239401 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.