DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and tsp-13

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_741692.1 Gene:tsp-13 / 189737 WormBaseID:WBGene00006639 Length:321 Species:Caenorhabditis elegans


Alignment Length:179 Identity:59/179 - (32%)
Similarity:90/179 - (50%) Gaps:24/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDF---------SGVGETF----TANSVAIII 56
            ||:.||.:|..||:|:|.|.||:..| :.:.|...|         ..|.|.|    |..:.:.||
 Worm    54 GVWAKYGIFTANIVFLIVGGLLLAMG-VWLRTDSRFRNFISERYRQAVQEAFWEAPTLFAFSYII 117

  Fly    57 LVLGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVD----HVQIQQSLEKI 117
            :|||.|:.:||.:||||....:...|..||:|:.:|||:.|:..||:...    .|::..:|..:
 Worm   118 IVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCGIYLLYKKDGLDVELSDALNYM 182

  Fly   118 VQTIWDQRKTDALLMDTLQRSFKCCGLNGFADYGI---TYPASC---CD 160
            ||..:.........:|.||.:|:|||..|.:|:.:   ..|.||   ||
 Worm   183 VQHYYQGPGVVQESLDHLQTAFRCCGNAGCSDFRVFRQDIPRSCDIRCD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 57/176 (32%)
tetraspanin_LEL 104..189 CDD:239401 18/67 (27%)
tsp-13NP_741692.1 Tetraspannin 58..269 CDD:278750 57/175 (33%)
tetraspanin_LEL 165..242 CDD:239401 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16965
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.