DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tspan8

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_598210.1 Gene:Tspan8 / 171048 RGDID:621783 Length:235 Species:Rattus norvegicus


Alignment Length:234 Identity:65/234 - (27%)
Similarity:119/234 - (50%) Gaps:40/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGV---GETFTANSVAI-IILVLGCVVFLVAF 68
            :||.:|.||.||.:||.|::.. :|.:...||...:   |:..|...:|: |::.:|.::.::.|
  Rat     8 LKYSMFFFNFLFWVCGTLILGL-AIWLRVSKDGKEIITSGDNGTNPFIAVNILIAVGSIIMVLGF 71

  Fly    69 MGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDALLMD 133
            :|||||::|:.|.|..:.:.:|::|:.|:|..|   :......:|...:.:|:::..|   ||.:
  Rat    72 LGCCGAVKESRCMLLLFFIGLLLILLLQVAAGI---LGATFKSESSRILNETLYENAK---LLSE 130

  Fly   134 T-------------LQRSFKCCGLN-GFADYGITYP---ASC------CDSPSNGTCALTQVMTR 175
            |             .|..||||||. |.||:|..:|   .||      |:| .||     :.:.|
  Rat   131 TSNEAKEVQKAMIAFQSEFKCCGLRFGAADWGKNFPDAKESCQCTGSDCES-YNG-----ENVYR 189

  Fly   176 SSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCL 214
            ::||..:....:.|:.|:.....|:..:|::..:|:..|
  Rat   190 TTCLSLIKELVEKNIIIVIGIAFGLAVIEILGLVFSMVL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 65/234 (28%)
tetraspanin_LEL 104..189 CDD:239401 27/107 (25%)
Tspan8NP_598210.1 Tetraspannin 8..228 CDD:395265 64/232 (28%)
TM4SF3_like_LEL 106..204 CDD:239407 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.