DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Cd53

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_031677.1 Gene:Cd53 / 12508 MGIID:88341 Length:219 Species:Mus musculus


Alignment Length:212 Identity:59/212 - (27%)
Similarity:112/212 - (52%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGV-GETFTANSVAIIILVLGCVVFLVAFMGC 71
            :||||||||:||.:||..::.||...:  :::..|| .......::..|::::|.::.:|||:||
Mouse     9 LKYVLFIFNLLFWVCGCCILGFGIYFL--VQNTYGVLFRNLPFLTLGNILVIVGSIIMVVAFLGC 71

  Fly    72 CGAIRENSCALTSYSVVMLVLLVSQ--LALIIYVWVDHVQ--IQQSLEKIVQTIWDQRKTDALLM 132
            .|:|:||.|.|.|:.|::|::|:::  :|::::|:...:.  :.:.|...:|.......| ....
Mouse    72 MGSIKENKCLLMSFFVLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQHYHSDNST-MKAW 135

  Fly   133 DTLQRSFKCCGLNGFADYGITYPASCCDSPSNGTCALTQVMTRSSCLKAVDSFWDTNVSIIKYAG 197
            |.:|...:|||:||.:|:....|:||   ||....        ..|.....|::.:|...|....
Mouse   136 DFIQTQLQCCGVNGSSDWTSGPPSSC---PSGADV--------QGCYNKAKSWFHSNFLYIGIIT 189

  Fly   198 LGVTAVELVAFIFACCL 214
            :.|..::::...||..|
Mouse   190 ICVCVIQVLGMSFALTL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 59/212 (28%)
tetraspanin_LEL 104..189 CDD:239401 18/86 (21%)
Cd53NP_031677.1 Tetraspannin 9..210 CDD:278750 59/212 (28%)
CD53_like_LEL 104..186 CDD:239417 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.