DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tsp68C

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:114/270 - (42%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANS-------------VAIIILVLG 60
            |:||.:.|.||:|||:||:..|..:.|..|... :.....|:|             :|:.:.:.|
  Fly     8 KFVLNLCNFLFLICGLLLVVSGLYIFSDNKRIL-LSRLLAASSDRLSSLPQPLLFYIALGVAIAG 71

  Fly    61 CVVFLVAFMGCCGAIRENSCALTSY--SVVMLVLLVSQLALIIYVW-------VDHVQIQQSLEK 116
            .|..|.|.:|...:.....|.||.|  |||:|:|..|.|.|.|.:|       :|..|:.:||:.
  Fly    72 FVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVRSLQS 136

  Fly   117 IVQTIWDQRKTDALLMDTLQRSFKCCGLNGFADYGIT-------------YPASCC--------- 159
            .......::.|:||  |..|..|.|||:....||..:             .|.|||         
  Fly   137 NYGVPGQEQFTNAL--DLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGHSM 199

  Fly   160 ----DSPSNGTCALTQVMTR---------SSCLKAVDSFWDTNVSIIKYAGLGVTAVE---LVAF 208
                ..|:|.  ::.|.:.|         .|||..:|:::....||...|.|.:..:|   |:|.
  Fly   200 AYLDPKPANE--SMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMIEFCVLLAI 262

  Fly   209 IFACC-LANQ 217
            |.:|. ||:|
  Fly   263 IMSCTGLASQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 74/268 (28%)
tetraspanin_LEL 104..189 CDD:239401 28/126 (22%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 71/263 (27%)
tetraspanin_LEL 117..241 CDD:239401 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.