DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and Tspan9

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001366065.1 Gene:Tspan9 / 109246 MGIID:1924558 Length:330 Species:Mus musculus


Alignment Length:226 Identity:62/226 - (27%)
Similarity:116/226 - (51%) Gaps:27/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFLVAFMGCC 72
            :||.:|:||::|.:||..|:..|..:..:..:|:....:|.:.|.|.:::.:|.:|.:..|:||.
Mouse   100 LKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGCL 164

  Fly    73 GAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDALLMDT--- 134
            |||:||.|.|.|:.:|:|::|:::|.|||..:|       .::|:.:......|...||.:|   
Mouse   165 GAIKENKCLLLSFFIVLLIILLAELILIILFFV-------YMDKVNENAKQDLKEGLLLYNTENN 222

  Fly   135 ---------LQRSFKCCGLNGFAD-YGI----TYPASCCDSPSNGTCA--LTQVMTRSSCLKAVD 183
                     :|...:|||:..:.| |.:    |.|..||...|.| |.  .|..:.|:.|.:.|.
Mouse   223 VGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQG-CGRNSTTPLWRTGCYEKVK 286

  Fly   184 SFWDTNVSIIKYAGLGVTAVELVAFIFACCL 214
            .::|.|..::...|:.:..::::...|:..|
Mouse   287 LWFDDNKHVLGTVGMCILIMQILGMAFSMTL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 62/226 (27%)
tetraspanin_LEL 104..189 CDD:239401 24/103 (23%)
Tspan9NP_001366065.1 Tetraspannin 100..317 CDD:395265 61/224 (27%)
NET-5_like_LEL 196..293 CDD:239418 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.