DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ed and TSPAN2

DIOPT Version :9

Sequence 1:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_005716.2 Gene:TSPAN2 / 10100 HGNCID:20659 Length:221 Species:Homo sapiens


Alignment Length:232 Identity:58/232 - (25%)
Similarity:107/232 - (46%) Gaps:32/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGV-FVKYVLFIFNILFVICGILLITFG--SIMVSTIKDFSGVGETFTANSVAIIILV-LGCVVF 64
            ||: .:||:|..||:||.:.|..:|.||  ......||:.|...::.....|.:.:|| .|.::.
Human     6 GGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMM 70

  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDH-VQIQQSLEKIVQTIWDQRKTD 128
            .|.|.|||||:||:.|.|.|:...:||:..:::...::.::.. |.|:.     |||::::...|
Human    71 AVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRH-----VQTMYEEAYND 130

  Fly   129 AL--------LMDTLQRSFKCCGLNGFADYGITYPASCCDSPSNGTCALTQVMTRSSCLKAVDSF 185
            .|        .:.|...:|:|||.........|.|              .:::...:|:..:::.
Human   131 YLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCP--------------KELLGHKNCIDEIETI 181

  Fly   186 WDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRNSQ 222
            ....:.:|...|:|:..:.:...||:..|....|||:
Human   182 ISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 53/220 (24%)
tetraspanin_LEL 104..189 CDD:239401 15/93 (16%)
TSPAN2NP_005716.2 Tetraspannin 11..210 CDD:395265 52/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.