DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and CD81

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_004347.1 Gene:CD81 / 975 HGNCID:1701 Length:236 Species:Homo sapiens


Alignment Length:243 Identity:53/243 - (21%)
Similarity:105/243 - (43%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCLSGIVNFILYIVNIVF-----LIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVL-- 59
            || :..:.::|::.|.||     :|:|:.|.:......::|...:: |....|||..:.:.:|  
Human     5 GC-TKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLEL-GDKPAPNTFYVGIYILIA 67

  Fly    60 -GGLIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSN-----LV 118
             |.::..|.|.||||..::|.|:.|.:.:.:.:||..::....|.|||:.....|:..     |.
Human    68 VGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQ 132

  Fly   119 NLLWDSHDYTAMGVLE---ETFGCCGDTSYTNY------NNIGLSVPGTCCGYLDRQATCNTPSV 174
            ..:.|.....|..|::   ||..|||.::.|..      ||:                 |.:.|.
Human   133 QAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNL-----------------CPSGSN 180

  Fly   175 YQS---RPGCSAKFEEFWNDNMDIIRWSGLG------LCIFDLVVFLI 213
            ..|   :..|..|.::.::..:.:|   |:.      :.||::::.::
Human   181 IISNLFKEDCHQKIDDLFSGKLYLI---GIAAIVVAVIMIFEMILSMV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 51/238 (21%)
tetraspanin_LEL 104..193 CDD:239401 21/105 (20%)
CD81NP_004347.1 Tetraspannin 10..226 CDD:395265 51/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.