DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and CD63

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:238 Identity:52/238 - (21%)
Similarity:119/238 - (50%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVF--LIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLI 63
            |.|    |.|:||::.:.|  ..||::.:.:|:.::  ||:..:.|: |..:.:|:.:..:|..:
Human     7 MKC----VKFLLYVLLLAFCACAVGLIAVGVGAQLV--LSQTIIQGA-TPGSLLPVVIIAVGVFL 64

  Fly    64 FVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSN-----LVNLLWD 123
            |:|:|.||.|..:::.|:...:...:.::.::::......:|.|...:.:.:|     :.|...:
Human    65 FLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKN 129

  Fly   124 SHDYTAMGVLEETFGCCGDTSYTNYNNI-GLS---VPGTCCGYLDRQATC----NTPSVYQSRPG 180
            :|..:.:..::..|.|||..:||::..| .:|   ||.:||  ::....|    |..:::  :.|
Human   130 NHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCC--INVTVGCGINFNEKAIH--KEG 190

  Fly   181 CSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGALTNCMRS 223
            |..|...:...|:.::..:.||:...:::..:.|..|...:||
Human   191 CVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 48/228 (21%)
tetraspanin_LEL 104..193 CDD:239401 22/101 (22%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 47/223 (21%)
CD63_LEL 105..203 CDD:239419 22/101 (22%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238 52/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.