DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and tspan37

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:227 Identity:44/227 - (19%)
Similarity:91/227 - (40%) Gaps:17/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFVVSFFG 70
            |.:...|.|..::||:.||..:. ||.:|.....:.:..|........:...|.|.::|:....|
Zfish     6 GAIGLFLKITCLLFLLTGITGLG-GSFLLHKYRVYGLFFSNLYIIFPALLAVVSGAILFITGSIG 69

  Fly    71 CYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWD------SHDYTA 129
            |....::..|..|.:...:.::|.:........:..:.....:::.|.::..:      ..|..|
Zfish    70 CLVSSKKPSCGHGLFVYFLIIVFCVVGTTAALAYFYQGKLDAELAPLKDVFQNYSNNSQDPDTKA 134

  Fly   130 MGVLEETFGCCGDTSYTN------YNNIG-LSVPGTCCG--YLDRQATCNTPSVYQSRPGCSAKF 185
            :..|:....|||..:||:      :|:.| ..||.:||.  :.....|.:.|.:..:. .|..|.
Zfish   135 VDRLQSELQCCGVMNYTDWLQTPWFNHSGKYDVPQSCCNTTFHSCNGTLDAPMLLYNE-ACQVKL 198

  Fly   186 EEFWNDNMDIIRWSGLGLCIFDLVVFLIAGAL 217
            :|.....:.||..:.|.:.:..::.::..|.|
Zfish   199 KELLLLVVHIIHITSLVVLVLLVLSWITVGQL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 43/226 (19%)
tetraspanin_LEL 104..193 CDD:239401 20/103 (19%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 34/181 (19%)
TM4SF8_like_LEL 102..195 CDD:239416 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.