DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and cd81b

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001003735.1 Gene:cd81b / 445280 ZFINID:ZDB-GENE-040808-52 Length:238 Species:Danio rerio


Alignment Length:244 Identity:60/244 - (24%)
Similarity:109/244 - (44%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCLSGIVNFILYIVNIVF-----LIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVL-- 59
            || |..:.::|:.:|.:|     :|:|:.|.:......|:|......|:.. |.|..|.|.||  
Zfish     5 GC-SQCIKYMLFFLNFIFWLAGGVILGVALWLRHDSQTSNLLMLQFEGNQA-PGTFYISVYVLIA 67

  Fly    60 -GGLIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLW- 122
             |.::..|.|.||||..::|.|:.|.:.:.:.:||..::....|.|:||.....::.|..:..: 
Zfish    68 IGAIMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFINRDTISTELINFYDAAYI 132

  Fly   123 ---DSHD----YTAMGVLE---ETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQS 177
               |..|    .||..|||   :...|||.   .:.|::...|..:.|   .::.....|.:.||
Zfish   133 KAVDPVDTTSRQTASKVLEVFHDNLDCCGK---GDDNDLFKVVQTSLC---PKKTFPLDPLISQS 191

  Fly   178 RPGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGALTNCMRSQNA 226
               |..|....:::.:.:|..:.|.:.:  ::||.:...:..|...:||
Zfish   192 ---CHVKLRNLFSEKLHVIGLAALVIAV--IMVFEMIFTMVLCCAIRNA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 54/232 (23%)
tetraspanin_LEL 104..193 CDD:239401 22/99 (22%)
cd81bNP_001003735.1 Tetraspannin 9..232 CDD:278750 55/234 (24%)
CD81_like_LEL 113..204 CDD:239404 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.