DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp97E

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:229 Identity:47/229 - (20%)
Similarity:87/229 - (37%) Gaps:44/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVL--GGLIFVVSFFGCYGI 74
            |..:||:::::|.|||.:|.          .|.:.:....:||...:|  |.::..:|..|..|.
  Fly    12 LIALNILYVMIGFLLIGVGV----------YARAASIVTNLPIVGGILACGVILICISMLGLAGA 66

  Fly    75 FRQSVCMTGAYTSMVFVLFILQL-VLTCWVFVNRSAFLGDMSNLVNLLWDSHDYTAMGVLEETFG 138
            .:....|...|..::|:||::|. :.:..:.||..    .........|.:........::::..
  Fly    67 VKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSE----QQQQFAEQGWMTVPTDLRKQVQDSLK 127

  Fly   139 CCGDTSYTNYNNIGLSVPGT----------CCGYLDRQATCNTPSVYQSRPGCSAK-FEEFWNDN 192
            |||         ...:.|.|          .|..:::|. |    .:.|.|.|..: ......|.
  Fly   128 CCG---------FNATAPSTTSVVPPSNEPSCELINQQC-C----AHSSEPDCRCEPCGPLLEDK 178

  Fly   193 MD-IIRWSGLGLCIFDLVVFLIAGALTNCMRSQN 225
            :| ..:..| ||.||.....::|..|....|:|:
  Fly   179 IDYAFKLCG-GLGIFFSFTEVLAVFLARRYRNQH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 45/223 (20%)
tetraspanin_LEL 104..193 CDD:239401 15/99 (15%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 44/220 (20%)
tetraspanin_LEL <121..177 CDD:243179 11/69 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442877
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.