DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp96F

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:291 Identity:62/291 - (21%)
Similarity:121/291 - (41%) Gaps:79/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVT--------- 57
            ||.| .|.:::.::||:|.::|:.::|....||            ||| |..:.:|         
  Fly     5 GCCS-CVKYLMVLINILFWLIGLTIVVTSVWML------------TDP-TFMLSMTQNYNHYHIA 55

  Fly    58 -----VLGGLIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDM--S 115
                 .:|.||.:.:||||.|:.|:|.|:..::..::.::.:.|:....|.|.|:.. |.|:  :
  Fly    56 LYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDK-LDDIVRA 119

  Fly   116 NLVNLLWDSHDYTAMG-------VLEETFGCC-----GDTSYTNYNNIG---------------L 153
            .:.:.:.:.:..:.|.       .|::...||     ||.:.:.:||:.               .
  Fly   120 AVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFY 184

  Fly   154 SVPGTCCG--------YLDRQATCNTP---SVYQSRPGCSAKFEEFWNDNMDIIRWSGLGLCIFD 207
            ::|.:||.        .|.|:.....|   ::||.  ||..|..|...:|...|......:.:.:
  Fly   185 NIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQ--GCVDKLIEIIYENWVTIFAVTAAVILLE 247

  Fly   208 LVVFLIAGALTNCMRS--------QNAGRQV 230
            |:....|.:|...:|:        ||:.|::
  Fly   248 LLSLTFALSLCCAVRNQHYKAXELQNSHREI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 55/267 (21%)
tetraspanin_LEL 104..193 CDD:239401 24/128 (19%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 55/267 (21%)
CD151_like_LEL 107..233 CDD:239408 24/128 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.