DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and zgc:64051

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_956665.1 Gene:zgc:64051 / 393342 ZFINID:ZDB-GENE-040426-1349 Length:221 Species:Danio rerio


Alignment Length:230 Identity:56/230 - (24%)
Similarity:98/230 - (42%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFV 65
            |.||. .:.:|:.:||.:|.|.|..:..:| |.|...||..:..| ....:|...:.:.|.:|..
Zfish     1 MSCLK-CLKYIMCVVNFIFFICGAAIFGMG-IYLMTFSRLSLLPS-LQAMSIANTLFITGIIITC 62

  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSA---FLGDMSNLVNLL------ 121
            |||.|..|..:::.|:..::..::|:|.:.:|...|.:.:..|.   |:.|  :||:.|      
Zfish    63 VSFLGFLGALKENRCLLISFFILLFILMLAELAAACLMLMYESKIENFIKD--DLVDGLNQSIKN 125

  Fly   122 ---------WDSHDYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQS 177
                     ||.        ::|||||||..:.|::...   ||          .:||.......
Zfish   126 RKQHNTTDDWDK--------VQETFGCCGIQNATDWQGF---VP----------QSCNISGTSNW 169

  Fly   178 RPGCSAKFEEFWNDNMDIIRWSGLG---LCIFDLV 209
            ..||....|..:..|   :..:|:|   :||.:::
Zfish   170 HKGCFKLLENSFESN---LLSTGIGVIVVCIIEVL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 53/224 (24%)
tetraspanin_LEL 104..193 CDD:239401 23/106 (22%)
zgc:64051NP_956665.1 Tetraspannin 6..213 CDD:278750 53/224 (24%)
CD53_like_LEL 101..189 CDD:239417 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.