DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp66E

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:65/267 - (24%)
Similarity:104/267 - (38%) Gaps:67/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVNFILYIVNIVFLIVGILLIV-----LGSIMLSDLSRFDVAGSGTDPNTI---PICVTVLGGLI 63
            |.|||.:::..:...||:.|.|     :..:.|.:..|.:   ..|.|..|   ...:.|:|.::
  Fly    16 IFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIE---QFTQPQAIEQLAYVLLVIGAVM 77

  Fly    64 FVVSFFGCYGIFRQSVCMTGAYTSMVFVLFI-----------------------LQLVLTCWVFV 105
            |.:||.|..|..|:|.|:...|.:.:.:|.|                       ||..:|     
  Fly    78 FFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTIT----- 137

  Fly   106 NRSAFLGDMSNLVNLLWDSHDYTAMGVLEETFGCCGDTSYTNY-------NNIG-LSVPGTCCGY 162
              |..||:..:..:|:|:.    .||    .|||||...|.::       |..| .::|..||..
  Fly   138 --SYSLGENVDATSLMWNQ----LMG----NFGCCGINDYHDFDASPAWVNGKGNRTIPDACCIL 192

  Fly   163 LD------RQATCNT-PSVYQS--RPGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGALT 218
            .|      |...|.| ||...|  :.||...|.|:.....::: ...:.:.|..||:.::|.||.
  Fly   193 KDVAKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRELV-IVAIAVGIVHLVLIILAFALC 256

  Fly   219 NCMRSQN 225
            ......|
  Fly   257 KAFAKYN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 64/261 (25%)
tetraspanin_LEL 104..193 CDD:239401 29/105 (28%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 64/260 (25%)
uroplakin_I_like_LEL 116..231 CDD:239409 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.