DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and tspan2a

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001018160.1 Gene:tspan2a / 378854 ZFINID:ZDB-GENE-050522-511 Length:211 Species:Danio rerio


Alignment Length:220 Identity:49/220 - (22%)
Similarity:94/220 - (42%) Gaps:36/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVL---GGLI 63
            ||:. .|.::|::.|.:|.:.|.|::.:|..:..|.....:......|....|.|.:|   ||::
Zfish     6 GCMK-CVKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAPENFFIAVYILIGAGGIM 69

  Fly    64 FVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDSHDYT 128
            .:|.||||:|..|:|.|:.|::.:.:.::|..::....:.|:|:...:.::.|.........:.|
Zfish    70 MIVGFFGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFLNKDQIIKEVQNYYESATKMENGT 134

  Fly   129 AM-GVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEFWNDN 192
            .: ........|||..|         |...||.               :....|....|:|:|:.
Zfish   135 VITSAFHSVLDCCGTES---------SPIETCT---------------EGNKDCVQAIEDFFNEK 175

  Fly   193 MDIIRWSGLGLC-------IFDLVV 210
            :.||.:.|:|:.       ||.:|:
Zfish   176 LFIIGYVGIGIAGVMVIGMIFSMVL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 47/215 (22%)
tetraspanin_LEL 104..193 CDD:239401 15/89 (17%)
tspan2aNP_001018160.1 Tetraspannin 10..204 CDD:278750 47/215 (22%)
tetraspanin_LEL 110..176 CDD:243179 15/89 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.