DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp47F

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:242 Identity:60/242 - (24%)
Similarity:123/242 - (50%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFD--VAGSGTDPNTIPICVTVLGGLIFV 65
            |...::.::|:..|::|.|.|:.:::.|:::|:|::.|:  |.|....|   ||.:.|.|.:||:
  Fly     4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAP---PIVLIVTGLIIFL 65

  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLV-NLLWD------ 123
            ::..||:|..::|..:...:..::.|:||::|.    |.:..|.|..|:..:| |.|.:      
  Fly    66 IASLGCFGAIKESPTLLITFAVLLAVIFIVELA----VGIAASVFKKDLEGMVKNSLQESIKRSN 126

  Fly   124 SHDYTAMGVLEETFGCCGDTSYTNYNNIGL--SVPGTCC--GYLDRQA--TCNTPSVYQSR---P 179
            |.|..|...:::...|||..|..::..:..  ::||:||  .|:|...  ...:|::.:.:   .
  Fly   127 SEDTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQV 191

  Fly   180 GCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGALTNCMRSQNA 226
            ||..|.::....|..|:...|:|:....::..::|..|.|.:|.:.|
  Fly   192 GCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQERA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 57/231 (25%)
tetraspanin_LEL 104..193 CDD:239401 23/104 (22%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 57/230 (25%)
uroplakin_I_like_LEL 102..205 CDD:239409 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.