DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp42Er

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:229 Identity:54/229 - (23%)
Similarity:108/229 - (47%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFV 65
            ||....::.::.::.|.:..::||..||:..|.:..::..|....|        ....:|.::|:
  Fly     1 MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILG--------LYIAVGSIVFL 57

  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLW--DSHDYT 128
            :|||||:|..::|:|:|.||.:.:.|:.|:.:|:   :||.|..|..|....:...:  .::.:.
  Fly    58 LSFFGCFGAIKESICVTWAYATSMLVMLIVSIVM---LFVFRMHFEEDSITKLKQAFAKQTNTFD 119

  Fly   129 AMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEFWNDNM 193
            ||...:..:.|||.....:|.:..::||.:|....|      ||    .|.||.||.|..:.:.:
  Fly   120 AMAEYQTQYQCCGIYKLKDYGDAYITVPSSCYDQND------TP----YRDGCLAKMETQYEELL 174

  Fly   194 ---DIIRWSGLGLCIFDLVVFLIAGALTNCMRSQ 224
               .|:.|.   |.:.::..|..:..:...:|::
  Fly   175 KGPKIVGWM---LMVIEIGAFTFSTIMGVSLRNE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 51/218 (23%)
tetraspanin_LEL 104..193 CDD:239401 23/90 (26%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 51/210 (24%)
tetraspanin_LEL 93..174 CDD:239401 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.