DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp42El

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:235 Identity:70/235 - (29%)
Similarity:113/235 - (48%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFV 65
            |||.:|.:.:.|::.|.::.|:|||:::.|.:           |.|..|:...|.:.:|||.|.|
  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGL-----------GWGAMPDAYAIGILILGGTILV 54

  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVN-RSAFLGDMSNLVNLLWDSHDYT- 128
            :|.|||.|..|:|..|...|.|:   |.||.|::..::.:| :..|.......|...|:..... 
  Fly    55 ISLFGCCGAVRESPRMLWTYASL---LLILLLLIVAFIILNPKDVFKKYALQTVENQWELEQTKP 116

  Fly   129 -AMGVLEETFGCCGDTSYTNYNNIGL---SVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEFW 189
             :|.::::|:.|||..|..:|.:|..   :||.:||    :..:|..|.....| ||..|.||.:
  Fly   117 GSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCC----KDDSCVNPLNLYVR-GCLIKVEEAF 176

  Fly   190 NDNMDIIRWSGLGLCIFDLVVFLIAGAL----TNCMRSQN 225
            .|....:.:...||..|:.|:.|:|..|    ||..|..|
  Fly   177 ADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRRYN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 64/223 (29%)
tetraspanin_LEL 104..193 CDD:239401 25/94 (27%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 58/207 (28%)
tetraspanin_LEL 94..178 CDD:239401 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.