DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:108/247 - (43%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGL--- 62
            ||..:..|..:|.::|.||.::|:.||..|...|...:.          |.:.|...|.|||   
  Fly     1 MGLGATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAE----------NAVSIGKNVAGGLIIA 55

  Fly    63 ----IFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSA------FLGDMSNL 117
                |.:::.|||.....::......|...|.:|.:.||     :|:..|:      ..|.::..
  Fly    56 LGVVILIIAIFGCLAAIHEAPVRLLIYVGAVVLLILAQL-----IFLGMSSHGTKDGISGSINEG 115

  Fly   118 VNLLWDS--HDYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATC-NTPS-VYQSR 178
            .:.||:|  :...|:...|....|||..|..:|..|...:|.:||    .::.| :||| |::: 
  Fly   116 FDRLWESERNQTGALSYYESWLQCCGVNSSEDYWIIHHGIPSSCC----PESKCMDTPSRVFKT- 175

  Fly   179 PGCSAKFEEFWNDNM---DIIRW-SGLGLCIFDLVVFLIAGALTNCMRSQNA 226
             ||.|.|.::.:|.:   .|:.| ..:|..:..:..:|:..::.|..|..||
  Fly   176 -GCKAAFVKYLDDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVKNQSRRNNA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 57/234 (24%)
tetraspanin_LEL 104..193 CDD:239401 27/98 (28%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 56/230 (24%)
DUF373 <17..>101 CDD:299895 23/98 (23%)
tetraspanin_LEL 104..189 CDD:239401 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467693
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.